Basic Information
| ID | DRAMP00100 |
|---|
| Sequence | KYYGNGVSCNSHGCSVNWGQAWTCGVNHLANGGHGVC |
|---|
| Length | 37 |
|---|
| Name | Sakacin G (SakG; Pediocin-like peptide; Bacteriocin) |
|---|
| Source | Lactobacillus sakei 2512 (Gram-positive bacteria) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
|---|
| Pathogen | Gram-positive bacteria: Streptococcus caprinus, S. macedonicus, Listeria innocua, L. sakei, L. ivanovii subsp. ivanovii and Listeria monocytogenes, Lactococcus lactis subsp. Lactis. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 12450870, 20152920 |
|---|
