| ID | DRAMP00092 |
|---|---|
| Sequence | ATYYGNGLYCNKQKHYTWVDWNKASREIGKIIVNGWVQH |
| Length | 39 |
| Name | Bacteriocin SRCAM 602 (Preclinical) |
| Source | Paenibacillus polymyxa (Bacillus polymyxa) (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacteria: Clostridium jejuni. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P86393 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15690798 |
Physicochemical Properties
| Residues | 39 |
|---|---|
| Sequence | ATYYGNGLYCNKQKHYTWVDWNKASREIGKIIVNGWVQH |
| Molecular Weight | 4642.174 |
| Grand Average of Hydropathy | -0.774 |
| Isoelectric Point | 9.307 |
| Charge at pH 7.4 | 2.638 |
| Secondary Structure | Helix: 0.359, Turn: 0.231, Sheet: 0.103 |
| Instability Index | 25.754 |
| Aromaticity | 0.179 |
