| ID | DRAMP18260 |
|---|---|
| Sequence | ATYYGNGLYCNKQKCWVDWNKASREIGKIIVNGWVQHGPWAPR |
| Length | 43 |
| Name | Bacteriocin 31 (Bacteriocin) |
| Source | Enterococcus faecalis Y1717 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive(narrow) |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8655558 |
Physicochemical Properties
| Residues | 43 |
|---|---|
| Sequence | ATYYGNGLYCNKQKCWVDWNKASREIGKIIVNGWVQHGPWAPR |
| Molecular Weight | 5008.656 |
| Grand Average of Hydropathy | -0.691 |
| Isoelectric Point | 9.448 |
| Charge at pH 7.4 | 3.579 |
| Secondary Structure | Helix: 0.326, Turn: 0.279, Sheet: 0.116 |
| Instability Index | 21.195 |
| Aromaticity | 0.163 |