| ID | DRAMP18266 |
|---|---|
| Sequence | TYYGNGLYCNKEKCWVDWNQAKGEIGKIIVNGWVNH |
| Length | 36 |
| Name | Bacteriocin T8(Bacteriocin) |
| Source | Enterococcus faecium (Streptococcus faecium) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q27HG2 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16820469, 17088377 |
Physicochemical Properties
| Residues | 36 |
|---|---|
| Sequence | TYYGNGLYCNKEKCWVDWNQAKGEIGKIIVNGWVNH |
| Molecular Weight | 4201.698 |
| Grand Average of Hydropathy | -0.636 |
| Isoelectric Point | 7.711 |
| Charge at pH 7.4 | 0.181 |
| Secondary Structure | Helix: 0.361, Turn: 0.278, Sheet: 0.111 |
| Instability Index | 2.931 |
| Aromaticity | 0.167 |