Basic Information
| ID | DRAMP00085 |
|---|
| Sequence | TSYGNGVHCNKSKCWIDVSELETYKAGTVSNPKDILWSLKE |
|---|
| Length | 41 |
|---|
| Name | Bacteriocin |
|---|
| Source | Lactococcus sp |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
|---|
| Pathogen | Gram-positive bacteria: Streptococcus aureus, Bacillus thuringiensis;##Gram-negative bacteria: Salmonella typhi, Klebsiella sp., Escherichia coli KL16 and Escherichia coli Gj137. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
P86291 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | PubMed ID is not available |
|---|
