| ID | DRAMP00097 |
|---|---|
| Sequence | TSYGNGVHCNKSKCWIDVSELETYKAGTVSNPKDILW |
| Length | 37 |
| Name | Lactococcin MMFII (Pediocin-like peptide; Bacteriocin) |
| Source | Lactococcus lactis subsp. lactis (Streptococcus lactis) (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Lactococcus cremoris, Listeria ivanovii. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P83002 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11728715, 11708769 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | TSYGNGVHCNKSKCWIDVSELETYKAGTVSNPKDILW |
| Molecular Weight | 4144.598 |
| Grand Average of Hydropathy | -0.535 |
| Isoelectric Point | 6.426 |
| Charge at pH 7.4 | -0.816 |
| Secondary Structure | Helix: 0.297, Turn: 0.297, Sheet: 0.135 |
| Instability Index | 27.616 |
| Aromaticity | 0.108 |