| ID | DRAMP00111 |
|---|---|
| Sequence | KYYGNGVHCGKKTCYVDWGQATASIGKIIVNGWTQHGPWAHR |
| Length | 42 |
| Name | Penocin A (PenA; Bacteriocin) |
| Source | Pediococcus pentosaceus (strain ATCC 25745/183-1w) (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacteria: Piscicola, Clostridia butyricum, Enterococcus faecium, Enterococcus faecalis, Lactobacillus curvatus, Lactobacillus casei, Lactobacillus sakeii, L. raffinolactis, Leuconostoc mesenteroides, Listeria innocua, Listeria monocytogenes, Pediococcus acidilactici, P. pentosaceus. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 17030793, 16735728 |
Physicochemical Properties
| Residues | 42 |
|---|---|
| Sequence | KYYGNGVHCGKKTCYVDWGQATASIGKIIVNGWTQHGPWAHR |
| Molecular Weight | 4689.257 |
| Grand Average of Hydropathy | -0.586 |
| Isoelectric Point | 9.448 |
| Charge at pH 7.4 | 3.601 |
| Secondary Structure | Helix: 0.286, Turn: 0.262, Sheet: 0.071 |
| Instability Index | -23.824 |
| Aromaticity | 0.143 |