| ID | DRAMP00067 |
|---|---|
| Sequence | KNYGNGVHCTKKGCSVDWGYAATNIANNSVMNGLTG |
| Length | 36 |
| Name | Leucocin C-TA33a (Bacteriocin) |
| Source | Leuconostoc mesenteroides TA33a (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9611809 |
Physicochemical Properties
| Residues | 36 |
|---|---|
| Sequence | KNYGNGVHCTKKGCSVDWGYAATNIANNSVMNGLTG |
| Molecular Weight | 3746.129 |
| Grand Average of Hydropathy | -0.439 |
| Isoelectric Point | 8.788 |
| Charge at pH 7.4 | 1.533 |
| Secondary Structure | Helix: 0.222, Turn: 0.389, Sheet: 0.139 |
| Instability Index | 6.189 |
| Aromaticity | 0.083 |