| ID | DRAMP00078 |
|---|---|
| Sequence | KNYGNGVHCTKKGCSVDWGYAWTNIANNSVMNGLTGGNAGWHN |
| Length | 43 |
| Name | Leucocin C (Leu C; Pediocin-like peptide; Bacteriocin) |
| Source | Leuconostoc mesenteroides (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P81053 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12127968, 9611809 |
Physicochemical Properties
| Residues | 43 |
|---|---|
| Sequence | KNYGNGVHCTKKGCSVDWGYAWTNIANNSVMNGLTGGNAGWHN |
| Molecular Weight | 4597.995 |
| Grand Average of Hydropathy | -0.665 |
| Isoelectric Point | 8.789 |
| Charge at pH 7.4 | 1.57 |
| Secondary Structure | Helix: 0.233, Turn: 0.419, Sheet: 0.116 |
| Instability Index | 18.093 |
| Aromaticity | 0.116 |