| ID | DRAMP00133 |
|---|---|
| Sequence | KKWGWLAWVDPAYEFIKGFGKGAIKEGNKDKWKNI |
| Length | 35 |
| Name | Lactococcin G subunit beta (Gbeta ; Bacteriocin) |
| Source | Lactococcus lactis subsp. lactis (Streptococcus lactis) (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Lactococcus. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P36962 |
| PDB | 2JPK, 2JPM |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 1512201, 18187052 |
Physicochemical Properties
| Residues | 35 |
|---|---|
| Sequence | KKWGWLAWVDPAYEFIKGFGKGAIKEGNKDKWKNI |
| Molecular Weight | 4109.729 |
| Grand Average of Hydropathy | -0.806 |
| Isoelectric Point | 9.7 |
| Charge at pH 7.4 | 3.538 |
| Secondary Structure | Helix: 0.343, Turn: 0.229, Sheet: 0.171 |
| Instability Index | 10.346 |
| Aromaticity | 0.2 |