| ID | DRAMP00152 |
|---|---|
| Sequence | GPGKWLPWLQPAYDFVTGLAKGIGKEGNKNKWKNV |
| Length | 35 |
| Name | Enterocin 1071B (Ent1071B; Bacteriocin) |
| Source | Enterococcus faecalis BFE 1071 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11976133 |
Physicochemical Properties
| Residues | 35 |
|---|---|
| Sequence | GPGKWLPWLQPAYDFVTGLAKGIGKEGNKNKWKNV |
| Molecular Weight | 3898.47 |
| Grand Average of Hydropathy | -0.731 |
| Isoelectric Point | 9.876 |
| Charge at pH 7.4 | 3.541 |
| Secondary Structure | Helix: 0.314, Turn: 0.343, Sheet: 0.171 |
| Instability Index | 42.929 |
| Aromaticity | 0.143 |