Basic Information
| ID | DRAMP01234 |
|---|
| Sequence | GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLNNIGNTGCNEDEC |
|---|
| Length | 48 |
|---|
| Name | Palustrin-3a (Frogs, amphibians, animals) |
|---|
| Source | Rana palustris (Pickerel frog) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
|---|
| Pathogen | Gram-negative bacterium: Escherichia coli (MIC=1 µM). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Cyclization (Cys43 and Cys48) |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
P84281 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 11087945 |
|---|
