Basic Information
| ID | DRAMP01471 |
| Sequence | GLFPKINKKKAKTGVFNIIKTVGKEAGMDLIRTGIDTIGCKIKGEC |
| Length | 46 |
| Name | Esculentin-1PLa (Frogs, amphibians, animals) |
| Source | Rana palustris (North American pickerel frog) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-negative bacterium: Escherichia coli (MIC=1 µM);##Gram-positive bacterium: Staphylococcus aureus (MIC=12 µM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | No cytotoxicity information found |
| N-terminal Modification | Free |
| C-terminal Modification | Cyclization (Cys40 and Cys46) |
| Linear/Cyclic/Branched | Cyclic |
| Uniprot |
|
| PDB |
|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 11087945 |
|---|