| ID | DRAMP02637 |
|---|---|
| Sequence | SARLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS |
| Length | 39 |
| Name | Antibacterial protein FALL-39 (FALL-39 peptide antibiotic; primates, mammals, animals) |
| Source | Macaca mulatta (Rhesus macaque) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q9GLV5 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11238224 |
Physicochemical Properties
| Residues | 39 |
|---|---|
| Sequence | SARLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS |
| Molecular Weight | 4259.012 |
| Grand Average of Hydropathy | -0.405 |
| Isoelectric Point | 11.203 |
| Charge at pH 7.4 | 7.237 |
| Secondary Structure | Helix: 0.308, Turn: 0.282, Sheet: 0.179 |
| Instability Index | -7.041 |
| Aromaticity | 0.077 |