| ID | DRAMP03572 |
|---|---|
| Sequence | FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Length | 39 |
| Name | Antibacterial protein FALL-39 (one chain of hCAP-18; Human, mammals, animals) |
| Source | Homo sapiens (Human) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P49913, Q71SN9 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 7529412, 8681941 |
Physicochemical Properties
| Residues | 39 |
|---|---|
| Sequence | FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Molecular Weight | 4711.515 |
| Grand Average of Hydropathy | -0.569 |
| Isoelectric Point | 10.605 |
| Charge at pH 7.4 | 5.547 |
| Secondary Structure | Helix: 0.359, Turn: 0.154, Sheet: 0.205 |
| Instability Index | 22.659 |
| Aromaticity | 0.128 |