| ID | DRAMP04071 |
|---|---|
| Sequence | LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS |
| Length | 37 |
| Name | LL-37 pentamide |
| Source | Synthetic construct |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacteria: Staphylococcus aureus 930918-3, S. aureuss 710A, S. aureuss ATCC (MRSA) 33591, Staphylococcus epidermidis ATCC 49741. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11557457 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS |
| Molecular Weight | 4522.355 |
| Grand Average of Hydropathy | -0.751 |
| Isoelectric Point | 12 |
| Charge at pH 7.4 | 10.542 |
| Secondary Structure | Helix: 0.351, Turn: 0.216, Sheet: 0.081 |
| Instability Index | 21.962 |
| Aromaticity | 0.135 |