| ID | DRAMP03571 |
|---|---|
| Sequence | [LL-37, 37 aa] |
| Length | 37 |
| Name | LL-37 |
| Source | Human lysosomes of polymorphonuclear leukocytes |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Anti-cancer |
| Pathogen | [Ref.29859288] Gram-negative bacteria:Escherichia coli (ATCC 25922)(MIC=25 ± 0 μg/ml);ESBL-producing Escherichia coli(MIC=33.3 ± 14.4μg/ml);NDM-1 producing Acinetobacter baumannii(MIC=20.8 ± 7.2 μg/ml);##Gram-positive bacteria:Staphylococcus aureus (ATCC 25923)(MIC=133.3 ± 57.7μg/ml);##Fungi:Candida albicans (ATCC 90028)(MIC>400μg/ml) |
| Hemolytic Activity | [Ref.29859288] 2.9 ± 0.7% Hemolysis at 500μg/ml against human red blood cell |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P49913, Q71SN9 |
| PDB | 2K6O resolved by NMR |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 29859288 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | [LL-37, 37 aa] |
| Molecular Weight | 4493.263 |
| Grand Average of Hydropathy | -0.724 |
| Isoelectric Point | 10.605 |
| Charge at pH 7.4 | 5.547 |
| Secondary Structure | Helix: 0.351, Turn: 0.162, Sheet: 0.189 |
| Instability Index | 23.343 |
| Aromaticity | 0.108 |