| ID | DRAMP02709 |
|---|---|
| Sequence | LLGDFFRKAKEKIGKESKRIVQRIKDFLRNLVPRTES |
| Length | 37 |
| Name | Antibacterial protein LL-37 (cathelicidin; primates, mammals, animals) |
| Source | Gorilla gorilla gorilla (Lowland gorilla) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q1KLY3 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16720578 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | LLGDFFRKAKEKIGKESKRIVQRIKDFLRNLVPRTES |
| Molecular Weight | 4417.167 |
| Grand Average of Hydropathy | -0.751 |
| Isoelectric Point | 10.605 |
| Charge at pH 7.4 | 5.547 |
| Secondary Structure | Helix: 0.324, Turn: 0.162, Sheet: 0.216 |
| Instability Index | 32.611 |
| Aromaticity | 0.081 |
