| ID | DRAMP04014 |
|---|---|
| Sequence | LLGDFFRKAKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Length | 37 |
| Name | LL-37A9 (LL-37 variants) |
| Source | Synthetic construct |
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
| Pathogen | Gram-negative bacteria: Escherichia coli DC2 (MIC=6 µM), Escherichia coli K12 (MIC=15 µM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 22185690 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | LLGDFFRKAKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Molecular Weight | 4477.264 |
| Grand Average of Hydropathy | -0.654 |
| Isoelectric Point | 10.605 |
| Charge at pH 7.4 | 5.547 |
| Secondary Structure | Helix: 0.351, Turn: 0.135, Sheet: 0.216 |
| Instability Index | 23.343 |
| Aromaticity | 0.108 |