| ID | DRAMP02607 |
|---|---|
| Sequence | QLGDVLQKAGEKIVRGLKNIGQRIKDFFGKLTPRTES |
| Length | 37 |
| Name | Antibacterial protein LL-37 (AFRLL-37; cathelicidin; primates, mammals, animals) |
| Source | Ateles fusciceps robustus (Colombian black-faced spider monkey) (Brown-headed spider monkey) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q1KLY8, Q1KLY7 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16720578 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | QLGDVLQKAGEKIVRGLKNIGQRIKDFFGKLTPRTES |
| Molecular Weight | 4141.774 |
| Grand Average of Hydropathy | -0.603 |
| Isoelectric Point | 10.161 |
| Charge at pH 7.4 | 3.548 |
| Secondary Structure | Helix: 0.297, Turn: 0.216, Sheet: 0.189 |
| Instability Index | 18.651 |
| Aromaticity | 0.054 |