| ID | DRAMP03189 |
|---|---|
| Sequence | VARLGGILRKAGEKIGGGLKKIGQKIKDFFGKLAPRTES |
| Length | 39 |
| Name | Antibacterial protein LL-39 (primates, mammals, animals) |
| Source | Saguinus oedipus (Cotton-top tamarin) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q1KLX0 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16720578 |
Physicochemical Properties
| Residues | 39 |
|---|---|
| Sequence | VARLGGILRKAGEKIGGGLKKIGQKIKDFFGKLAPRTES |
| Molecular Weight | 4138.903 |
| Grand Average of Hydropathy | -0.326 |
| Isoelectric Point | 10.709 |
| Charge at pH 7.4 | 6.508 |
| Secondary Structure | Helix: 0.282, Turn: 0.256, Sheet: 0.231 |
| Instability Index | 20.713 |
| Aromaticity | 0.051 |