Basic Information
| ID | DRAMP00159 |
| Sequence | GFWGGLGYIAGRVGAAYGHAQASANNHHSPING |
| Length | 33 |
| Name | Lactocin 705beta (lac705beta; chain b of Lactocin 705; Bacteriocin) |
| Source | Lactobacillus casei CRL 705 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Several lactic acid bacteria, Listeria, Streptococci, etc. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot |
|
| PDB |
|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 10754241 |
|---|