| ID | DRAMP00130 |
|---|---|
| Sequence | SIWGDIGQGVGKAAYWVGKAMGNMSDVNQASRINRKKKH |
| Length | 39 |
| Name | Lactococcin Q alpha (Qalpha; Bacteriocin) |
| Source | Lactococcus lactis QU 4 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacterium: Lactococcus lactis subsp. lactis ATCC 19435 (MIC>1000 nM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q1JV79 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16672481 |
Physicochemical Properties
| Residues | 39 |
|---|---|
| Sequence | SIWGDIGQGVGKAAYWVGKAMGNMSDVNQASRINRKKKH |
| Molecular Weight | 4259.831 |
| Grand Average of Hydropathy | -0.692 |
| Isoelectric Point | 10.289 |
| Charge at pH 7.4 | 4.276 |
| Secondary Structure | Helix: 0.231, Turn: 0.308, Sheet: 0.154 |
| Instability Index | 5.636 |
| Aromaticity | 0.077 |