| ID | DRAMP00151 |
|---|---|
| Sequence | ESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH |
| Length | 39 |
| Name | Enterocin 1071A (Ent1071A; Bacteriocin) |
| Source | Enterococcus faecalis BFE 1071 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11976133 |
Physicochemical Properties
| Residues | 39 |
|---|---|
| Sequence | ESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH |
| Molecular Weight | 4285.841 |
| Grand Average of Hydropathy | -0.462 |
| Isoelectric Point | 9.822 |
| Charge at pH 7.4 | 2.692 |
| Secondary Structure | Helix: 0.282, Turn: 0.308, Sheet: 0.205 |
| Instability Index | 14.062 |
| Aromaticity | 0.077 |