| ID | DRAMP00132 |
|---|---|
| Sequence | GTWDDIGQGIGRVAYWVGKALGNLSDVNQASRINRKKKH |
| Length | 39 |
| Name | Lactococcin G subunit alpha (Galpha; Bacteriocin) |
| Source | Lactococcus lactis subsp. lactis (Streptococcus lactis) (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Lactococcus. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P36961 |
| PDB | 2JPJ, 2JPL |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 1512201, 18187052 |
Physicochemical Properties
| Residues | 39 |
|---|---|
| Sequence | GTWDDIGQGIGRVAYWVGKALGNLSDVNQASRINRKKKH |
| Molecular Weight | 4309.803 |
| Grand Average of Hydropathy | -0.744 |
| Isoelectric Point | 10.161 |
| Charge at pH 7.4 | 3.583 |
| Secondary Structure | Helix: 0.282, Turn: 0.282, Sheet: 0.128 |
| Instability Index | -6.826 |
| Aromaticity | 0.077 |