| ID | DRAMP18243 |
|---|---|
| Sequence | SLGVTLGAAGLYTATQTIATQIWKCGAVLTTSAECSRTGNSC |
| Length | 42 |
| Name | Ticin A1(Bacteriocin) |
| Source | Bacillus thuringiensis BMB3201 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 26231642 |
Physicochemical Properties
| Residues | 42 |
|---|---|
| Sequence | SLGVTLGAAGLYTATQTIATQIWKCGAVLTTSAECSRTGNSC |
| Molecular Weight | 4206.732 |
| Grand Average of Hydropathy | 0.369 |
| Isoelectric Point | 7.688 |
| Charge at pH 7.4 | 0.176 |
| Secondary Structure | Helix: 0.238, Turn: 0.238, Sheet: 0.262 |
| Instability Index | 16.852 |
| Aromaticity | 0.048 |
