| ID | DRAMP01669 |
|---|---|
| Sequence | ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ |
| Length | 34 |
| Name | Dermaseptin-2 (DS II; Dermaseptin-S2, DS2; Frogs, amphibians, animals) |
| Source | Phyllomedusa sauvagei (Sauvage's leaf frog) |
| Activity | Antimicrobial, Antibacterial, Antifungal, Antiprotozoal |
| Pathogen | Aspergillus fumigatus. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P80278 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8306981 |
Physicochemical Properties
| Residues | 34 |
|---|---|
| Sequence | ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ |
| Molecular Weight | 3473.075 |
| Grand Average of Hydropathy | 0.382 |
| Isoelectric Point | 10.302 |
| Charge at pH 7.4 | 2.637 |
| Secondary Structure | Helix: 0.235, Turn: 0.176, Sheet: 0.441 |
| Instability Index | 6.268 |
| Aromaticity | 0.059 |