| ID | DRAMP04072 |
|---|---|
| Sequence | KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYKGSYSMEHFRWGKPV |
| Length | 51 |
| Name | Hinnavin II/MSH hybrid (rhin/MSH) |
| Source | Synthetic construct |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 20221725 |
Physicochemical Properties
| Residues | 51 |
|---|---|
| Sequence | KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYKGSYSMEHFRWGKPV |
| Molecular Weight | 5800.761 |
| Grand Average of Hydropathy | -0.388 |
| Isoelectric Point | 10.093 |
| Charge at pH 7.4 | 5.611 |
| Secondary Structure | Helix: 0.314, Turn: 0.216, Sheet: 0.176 |
| Instability Index | 22.904 |
| Aromaticity | 0.118 |