| ID | DRAMP00180 |
|---|---|
| Sequence | SLQYVMSAGPYTWYKDTRTGKTICKQTIDTASYTFGVMAEGWGKTFH |
| Length | 47 |
| Name | Lactococcin-B (LCN-B; Bacteriocin) |
| Source | Lactococcus lactis subsp (Streptococcus cremoris) (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Lactococcus. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P35518 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 1610182, 8885398 |
Physicochemical Properties
| Residues | 47 |
|---|---|
| Sequence | SLQYVMSAGPYTWYKDTRTGKTICKQTIDTASYTFGVMAEGWGKTFH |
| Molecular Weight | 5327.975 |
| Grand Average of Hydropathy | -0.445 |
| Isoelectric Point | 8.889 |
| Charge at pH 7.4 | 1.247 |
| Secondary Structure | Helix: 0.277, Turn: 0.191, Sheet: 0.149 |
| Instability Index | 19.168 |
| Aromaticity | 0.17 |