| ID | DRAMP00184 |
|---|---|
| Sequence | EGTWQHGYGVSSAYSNYHHGSKTHSATVVNNNTGRQGKDTQRAGVWAKATVGRNLTEKASFYYNFW |
| Length | 66 |
| Name | Lactococcin 972 (Lcn972; homodimer; Bacteriocin) |
| Source | Lactococcus lactis subsp. lactis IPLA 972 (Streptococcus lactis) (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Lactococcus. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | O86283 |
| PDB | 2LGN |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 10589723, 21818877, PubMed ID is not available |
Physicochemical Properties
| Residues | 66 |
|---|---|
| Sequence | EGTWQHGYGVSSAYSNYHHGSKTHSATVVNNNTGRQGKDTQRAGVWAKATVGRNLTEKASFYYNFW |
| Molecular Weight | 7380.862 |
| Grand Average of Hydropathy | -0.982 |
| Isoelectric Point | 9.698 |
| Charge at pH 7.4 | 3.793 |
| Secondary Structure | Helix: 0.242, Turn: 0.303, Sheet: 0.136 |
| Instability Index | 6.753 |
| Aromaticity | 0.152 |