| ID | DRAMP18327 |
|---|---|
| Sequence | ESISVAGGTWNYGYGVGQAYSHYKHDYNNHGAKVVNSNNGVKDYKNAGPGVWAKASIGTVWDPATFYYNPTGFYSN |
| Length | 76 |
| Name | Sil(Bacteriocin) |
| Source | Streptococcus iniae SF1 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 24781647 |
Physicochemical Properties
| Residues | 76 |
|---|---|
| Sequence | ESISVAGGTWNYGYGVGQAYSHYKHDYNNHGAKVVNSNNGVKDYKNAGPGVWAKASIGTVWDPATFYYNPTGFYSN |
| Molecular Weight | 8284.826 |
| Grand Average of Hydropathy | -0.693 |
| Isoelectric Point | 8.242 |
| Charge at pH 7.4 | 0.744 |
| Secondary Structure | Helix: 0.303, Turn: 0.382, Sheet: 0.105 |
| Instability Index | 17.683 |
| Aromaticity | 0.184 |
