| ID | DRAMP00225 |
|---|---|
| Sequence | ILFSYLLFYVLKENSKREDKYQNIIEELTELLPKIKEDVEDIKEKLNK |
| Length | 48 |
| Name | Bacteriocin UviB |
| Source | Clostridium perfringens (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P15936 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 2901768, 2460717 |
Physicochemical Properties
| Residues | 48 |
|---|---|
| Sequence | ILFSYLLFYVLKENSKREDKYQNIIEELTELLPKIKEDVEDIKEKLNK |
| Molecular Weight | 5873.742 |
| Grand Average of Hydropathy | -0.606 |
| Isoelectric Point | 5.024 |
| Charge at pH 7.4 | -2.46 |
| Secondary Structure | Helix: 0.417, Turn: 0.125, Sheet: 0.333 |
| Instability Index | 66.871 |
| Aromaticity | 0.104 |
