Basic Information
| ID | DRAMP00229 |
| Sequence | KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGVKHSSGGGGSYHC |
| Length | 43 |
| Name | Bacteriocin plantarican ASM1 (PASM1; Bacteriocin) |
| Source | Lactobacillus plantarum A-1 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacteria: Lactobacillus plantarum, L. pentosus, L. curvatus, L. lindneri, Leuconostoc mesenteroides and Enterococcus faecalis. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot |
C7G1H4 |
| PDB |
|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 19939484 |
|---|