| ID | DRAMP00248 |
|---|---|
| Sequence | KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGIKHHSSGSSSYHC |
| Length | 43 |
| Name | Glycocin F (GccF; S-glycosylated bacteriocin) |
| Source | Lactobacillus plantarum KW30 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacterium: Lactobacillus plantarum ATCC 8014 (IC50=2 nM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | E9K9Z1 |
| PDB | 2KUY |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 21395300, 21251913 |
Physicochemical Properties
| Residues | 43 |
|---|---|
| Sequence | KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGIKHHSSGSSSYHC |
| Molecular Weight | 4800.327 |
| Grand Average of Hydropathy | -0.319 |
| Isoelectric Point | 7.043 |
| Charge at pH 7.4 | -0.435 |
| Secondary Structure | Helix: 0.233, Turn: 0.302, Sheet: 0.140 |
| Instability Index | 52.651 |
| Aromaticity | 0.186 |