| ID | DRAMP00275 |
|---|---|
| Sequence | GSSFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP |
| Length | 63 |
| Name | Snakin-1 (StSN1; Cys-rich; Plant defensin) |
| Source | Solanum tuberosum (potato) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Antifungal |
| Pathogen | [Ref.9885189] Gram-positive bacteria: Listeria monocytogenes (MIC=10 µg/mL), Listeria innocua (MIC=10 µg/mL), Listeria ivanovii (MIC=10 µg/mL), Clavibacter michiganensis (EC50=1 µM), Ralstonia solanacearum (rfa-) (EC50=30 µM), Rhizobium meliloti (EC50=8 µM).##Fungi: Botrytis cinerea (EC50=2 µM), Fusarium solani (EC50=3 µM), Fusarium culmorum (EC50=2 µM), Fusarium oxysporum f. sp. conglutinans (EC50=10 µM), Fusarium oxysporum f. sp. lycopersici (EC50=20 µM), Plectosphaerella cucumerina (EC50=10 µM), Colletotrichum graminicola (EC50=10 µM), Colletotrichum lagenarium (EC50=10 µM), Bipolaris maydis (EC50=20 µM), Aspergillus flavus (EC50=20 µM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | No cytotoxicity information found |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Linear/Cyclic/Branched | Cyclic |
| Uniprot | Q948Z4 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11891250, 9885189 |
Physicochemical Properties
| Residues | 63 |
|---|---|
| Sequence | GSSFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP |
| Molecular Weight | 6907.04 |
| Grand Average of Hydropathy | -0.77 |
| Isoelectric Point | 8.975 |
| Charge at pH 7.4 | 7.27 |
| Secondary Structure | Helix: 0.143, Turn: 0.286, Sheet: 0.127 |
| Instability Index | 40.487 |
| Aromaticity | 0.063 |