| ID | DRAMP00365 |
|---|---|
| Sequence | AISCGAVTGDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCMKSAASSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTVK |
| Length | 92 |
| Name | Non-specific lipid-transfer protein 5 (Lc-LTP5; Plants) |
| Source | Lens culinaris (Lentil) (Cicer lens) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | A0AT31 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 17511608 |
Physicochemical Properties
| Residues | 92 |
|---|---|
| Sequence | AISCGAVTGDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCMKSAASSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTVK |
| Molecular Weight | 9148.465 |
| Grand Average of Hydropathy | 0.003 |
| Isoelectric Point | 9.034 |
| Charge at pH 7.4 | 5.39 |
| Secondary Structure | Helix: 0.185, Turn: 0.348, Sheet: 0.217 |
| Instability Index | 33.064 |
| Aromaticity | 0.022 |