| ID | DRAMP03501 |
|---|---|
| Sequence | AIGCNTVASKMAPCLPYVTGKGPLGGCCGGVKGLIDAARTTPDRQAVCNCLKTLAKSYSGINLGNAAGLPGKCGVSIPYQISPNTDCSKVH |
| Length | 91 |
| Name | La-LTP (LJAFP; Insects, animals) |
| Source | Leonurus japonicus (Chinese motherwort) (Leonurus artemisia) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
| Pathogen | Gram-positive Bacteria: Bacillus subtilis (IC50>15 µM). ##Gram-negative Bacteria: Pseudomonas solanacearum (IC50=7.5-15 µM), Ralstonia solanacearum (IC50=15 µM).##Fungi: Alternaria alternate (IC50<7.5 µM), Alternaria brassicae (IC50<7.5 µM), Aspergillus niger (IC50<7.5 µM), Bipolaris maydis (IC50<7.5 µM), Botrytis cinerea (IC50=7.5-15 µM), Cerospora personata (IC50=7.5-15 µM), Colletotrichum gloeosporiodes (IC50<7.5 µM), Fusarium graminearum (IC50=7.5-15 µM), Fusarium oxysporum (IC50=7.5-15 µM), Penicillium digitatum (IC50>15 µM), Pyricularia grisea (IC50=7.5-15 µM), Rhizoctonia solani (IC50<7.5 µM), Rhizoctonia cerealis (IC50=7.5-15 µM), Saccharomyces cerevisiae (IC50>15 µM), Sclerotinia sclerotiorum (IC50>15 µM), Trichoderma harzianum (IC50=7.5-15 µM), Verticillium dahliae (IC50=7.5-15 µM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q52RN7 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | PubMed ID is not available |
Physicochemical Properties
| Residues | 91 |
|---|---|
| Sequence | AIGCNTVASKMAPCLPYVTGKGPLGGCCGGVKGLIDAARTTPDRQAVCNCLKTLAKSYSGINLGNAAGLPGKCGVSIPYQISPNTDCSKVH |
| Molecular Weight | 9125.563 |
| Grand Average of Hydropathy | 0.095 |
| Isoelectric Point | 9.019 |
| Charge at pH 7.4 | 5.425 |
| Secondary Structure | Helix: 0.231, Turn: 0.341, Sheet: 0.187 |
| Instability Index | 20.437 |
| Aromaticity | 0.033 |