Basic Information
| ID | DRAMP01627 |
|---|
| Sequence | YPPKPESPGEDASPEEMNKYLTALRHYINLVTRQRY |
|---|
| Length | 36 |
|---|
| Name | Skin peptide tyrosine-tyrosine (Skin-PYY; SPYY; Frogs, amphibians, animals) |
|---|
| Source | Phyllomedusa bicolor (Two-colored leaf frog) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
|---|
| Pathogen | Gram-negative bacteria: Aeromonas caviae (MIC=40 µg/ml), Escherichia coli (MIC=10 µg/ml);##Gram-positive bacteria: Enterococcus faecalis (MIC=10 µg/ml), Nocardia brasiliensis (MIC=20 µg/ml).##Fungi: Cryptococcus neoformans (MIC=20 µg/ml), Candida albicans (MIC=15 µg/ml), Microsporum canis (MIC=10 µg/ml), Tricophyton rubrum (MIC=15 µg/ml), Arthroderma simii (MIC=10 µg/ml), Aspergillus fumigatus (MIC=80 µg/ml), Aspergillus niger (MIC>100 µg/ml). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | [Ref.8601432]<20% cytotoxic against murine macrophages at the concentration up to 100μg/ml##[Ref.7937944]No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Amidation |
|---|
| Linear/Cyclic/Branched | Linear |
|---|
| Uniprot |
P80952 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 7937944, 8601432 |
|---|
