| ID | DRAMP04254 |
|---|---|
| Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
| Length | 36 |
| Name | Neuropeptide Y (NPY) |
| Source | Synthetic construct |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9756788 |
Physicochemical Properties
| Residues | 36 |
|---|---|
| Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
| Molecular Weight | 4272.669 |
| Grand Average of Hydropathy | -1.194 |
| Isoelectric Point | 6.762 |
| Charge at pH 7.4 | -0.417 |
| Secondary Structure | Helix: 0.250, Turn: 0.250, Sheet: 0.250 |
| Instability Index | 63.739 |
| Aromaticity | 0.139 |