| ID | DRAMP02479 |
|---|---|
| Sequence | QDRPKKPGLCPPRPQKPPCVKECKNDWSCPGQQKCCSYGCIDECRDPIFVN |
| Length | 51 |
| Name | Scuwaprin-a (Snakes, reptiles, animals) |
| Source | Oxyuranus scutellatus scutellatus (Australian taipan) (Coastaltaipan) |
| Activity | Antimicrobial, Antibacterial, Antimalarial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | B5G6G8 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 18979207 |
Physicochemical Properties
| Residues | 51 |
|---|---|
| Sequence | QDRPKKPGLCPPRPQKPPCVKECKNDWSCPGQQKCCSYGCIDECRDPIFVN |
| Molecular Weight | 5793.686 |
| Grand Average of Hydropathy | -1.065 |
| Isoelectric Point | 8.488 |
| Charge at pH 7.4 | 2.348 |
| Secondary Structure | Helix: 0.157, Turn: 0.314, Sheet: 0.059 |
| Instability Index | 56.316 |
| Aromaticity | 0.059 |