| ID | DRAMP02491 |
|---|---|
| Sequence | QDHPKKPGLCPPRPQKPPCVRECKNDWSCPGEQKCCRYGCIFECRDPIFVK |
| Length | 51 |
| Name | Stewaprin-a (Snakes, reptiles, animals) |
| Source | Hoplocephalus stephensii (Stephens' banded snake) |
| Activity | Antimicrobial, Antibacterial, Antimalarial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | B5G6H3 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 18979207 |
Physicochemical Properties
| Residues | 51 |
|---|---|
| Sequence | QDHPKKPGLCPPRPQKPPCVRECKNDWSCPGEQKCCRYGCIFECRDPIFVK |
| Molecular Weight | 5918.902 |
| Grand Average of Hydropathy | -1.008 |
| Isoelectric Point | 8.711 |
| Charge at pH 7.4 | 3.385 |
| Secondary Structure | Helix: 0.176, Turn: 0.275, Sheet: 0.078 |
| Instability Index | 50.496 |
| Aromaticity | 0.078 |