| ID | DRAMP02481 |
|---|---|
| Sequence | QDRPKKPGLCPPRPQKPCVKECKNDWSCPGQQKCCNYGCIDECRDPIFVN |
| Length | 50 |
| Name | Omwaprin-c (Oxywaprin-c; Snakes, reptiles, animals) |
| Source | Oxyuranus microlepidotus (Inland taipan) |
| Activity | Antimicrobial, Antibacterial, Antimalarial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | B5L5M9 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 18979207 |
Physicochemical Properties
| Residues | 50 |
|---|---|
| Sequence | QDRPKKPGLCPPRPQKPCVKECKNDWSCPGQQKCCNYGCIDECRDPIFVN |
| Molecular Weight | 5723.596 |
| Grand Average of Hydropathy | -1.108 |
| Isoelectric Point | 8.488 |
| Charge at pH 7.4 | 2.348 |
| Secondary Structure | Helix: 0.160, Turn: 0.300, Sheet: 0.060 |
| Instability Index | 53.39 |
| Aromaticity | 0.06 |