| ID | DRAMP02624 |
|---|---|
| Sequence | VKGGIEKAGVCPADNVRCFKSNPPQCHTDQDCLGERKCCYLHCGFKCVIPVKKLEEGGNKDEDVSGPHPEPGWEAKSPGSSSTGCPQI |
| Length | 88 |
| Name | WAP four-disulfide core domain protein 12 (primates, mammals, animals) |
| Source | Colobus guereza (Black-and-white colobus monkey) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | A4K2P8 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 17267810 |
Physicochemical Properties
| Residues | 88 |
|---|---|
| Sequence | VKGGIEKAGVCPADNVRCFKSNPPQCHTDQDCLGERKCCYLHCGFKCVIPVKKLEEGGNKDEDVSGPHPEPGWEAKSPGSSSTGCPQI |
| Molecular Weight | 9386.54 |
| Grand Average of Hydropathy | -0.685 |
| Isoelectric Point | 6.305 |
| Charge at pH 7.4 | -1.603 |
| Secondary Structure | Helix: 0.182, Turn: 0.330, Sheet: 0.148 |
| Instability Index | 50.339 |
| Aromaticity | 0.045 |