| ID | DRAMP03589 |
|---|---|
| Sequence | VKEGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK |
| Length | 88 |
| Name | WAP four-disulfide core domain protein 12 (Putative protease inhibitor WAP12; Human, mammals, ani |
| Source | Homo sapiens (Human) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8WWY7, Q5H980, Q9BR31 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11779191 |
Physicochemical Properties
| Residues | 88 |
|---|---|
| Sequence | VKEGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK |
| Molecular Weight | 9715.913 |
| Grand Average of Hydropathy | -0.845 |
| Isoelectric Point | 5.662 |
| Charge at pH 7.4 | -2.664 |
| Secondary Structure | Helix: 0.182, Turn: 0.273, Sheet: 0.170 |
| Instability Index | 55.46 |
| Aromaticity | 0.057 |