| ID | DRAMP03402 |
|---|---|
| Sequence | RPEIKKKNVFSKPGYCPEYRVPCPFVLIPKCRRDKGCKDALKCCFFYCQMRCVDPWESPE |
| Length | 60 |
| Name | WAP four-disulfide core domain protein 15B (Elafin-like protein I; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-negative bacterium: Escherichia coli (IC90=10 µM);##Gram-positive bacterium: Staphylococcus aureus (IC90=10 µM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q9JHY4, A2A5M6, Q8BVC0 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12574366 |
Physicochemical Properties
| Residues | 60 |
|---|---|
| Sequence | RPEIKKKNVFSKPGYCPEYRVPCPFVLIPKCRRDKGCKDALKCCFFYCQMRCVDPWESPE |
| Molecular Weight | 7134.447 |
| Grand Average of Hydropathy | -0.615 |
| Isoelectric Point | 9.004 |
| Charge at pH 7.4 | 5.342 |
| Secondary Structure | Helix: 0.267, Turn: 0.217, Sheet: 0.133 |
| Instability Index | 43.655 |
| Aromaticity | 0.133 |