| ID | DRAMP03401 |
|---|---|
| Sequence | QPRATRKGVTPKQGYCPEFLLDCPFVLLPVCSRDKGCKGTKKCCFYYCQMRCVEPWTTLT |
| Length | 60 |
| Name | WAP four-disulfide core domain protein 15A (Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8BH89 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16141072 |
Physicochemical Properties
| Residues | 60 |
|---|---|
| Sequence | QPRATRKGVTPKQGYCPEFLLDCPFVLLPVCSRDKGCKGTKKCCFYYCQMRCVEPWTTLT |
| Molecular Weight | 6896.159 |
| Grand Average of Hydropathy | -0.317 |
| Isoelectric Point | 9.032 |
| Charge at pH 7.4 | 5.342 |
| Secondary Structure | Helix: 0.267, Turn: 0.183, Sheet: 0.150 |
| Instability Index | 31.923 |
| Aromaticity | 0.117 |