| ID | DRAMP02773 |
|---|---|
| Sequence | DVKGMKKAIKGILDCVIEKGYDKLAAKLKKVIQQLWE |
| Length | 37 |
| Name | Pilosulin 5 (Myr b III; ants, insects, animals) |
| Source | Myrmecia banksi (Jack jumper ant) (Australian jumper ant) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | A9CM07 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 18544336, 16376960 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | DVKGMKKAIKGILDCVIEKGYDKLAAKLKKVIQQLWE |
| Molecular Weight | 4202.078 |
| Grand Average of Hydropathy | -0.2 |
| Isoelectric Point | 9.467 |
| Charge at pH 7.4 | 3.514 |
| Secondary Structure | Helix: 0.351, Turn: 0.081, Sheet: 0.270 |
| Instability Index | 16.759 |
| Aromaticity | 0.054 |