| ID | DRAMP03503 |
|---|---|
| Sequence | RWKFFKKIERVGQNVRDGLIKAGPAIQVLGAAKAL |
| Length | 35 |
| Name | Hyphancin-3E (Hyphancin IIIE; Cecropin-A1; Insects, animals) |
| Source | Hyphantria cunea (Fall webworm moth) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P50721 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | PubMed ID is not available |
Physicochemical Properties
| Residues | 35 |
|---|---|
| Sequence | RWKFFKKIERVGQNVRDGLIKAGPAIQVLGAAKAL |
| Molecular Weight | 3879.602 |
| Grand Average of Hydropathy | -0.071 |
| Isoelectric Point | 11.122 |
| Charge at pH 7.4 | 5.546 |
| Secondary Structure | Helix: 0.343, Turn: 0.171, Sheet: 0.257 |
| Instability Index | 27.986 |
| Aromaticity | 0.086 |
