| ID | DRAMP18491 |
|---|---|
| Sequence | RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK |
| Length | 37 |
| Name | CecropinXJ (Insects, arthropods, invertebrates, animals) |
| Source | Bombyx mori |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-cancer |
| Pathogen | Gram-positive bacteria: Staphylococcus aureus (MIC= 1.81 |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 23500722 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK |
| Molecular Weight | 4079.902 |
| Grand Average of Hydropathy | -0.243 |
| Isoelectric Point | 10.709 |
| Charge at pH 7.4 | 6.543 |
| Secondary Structure | Helix: 0.297, Turn: 0.216, Sheet: 0.216 |
| Instability Index | 61.876 |
| Aromaticity | 0.054 |