Basic Information
| ID | DRAMP21414 |
|---|
| Sequence | RWKIFKKIEKMGRNIRDGIVKAGPAIQVLGSAKAI |
|---|
| Length | 35 |
|---|
| Name | CecB Q53 (Derived from CecB E53) |
|---|
| Source | synthetic construct |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
|---|
| Pathogen | [Ref.31045339] Gram-positive bacteria: Staphylococcus aureus ATCC BAA-44(MIC>20μM), Staphylococcus epidermidis ATCC 700565(MIC=8μM);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC=0.15μM), Pseudomonas aeruginosa ATCC 27853(MIC=2.2μM), Pseudomonas aeruginosa ATCC 25668(MIC=2.2μM);##Fungi:Candida albicans ATCC 1023(MIC>20μM) |
|---|
| Hemolytic Activity | [Ref.31045339] 0.1% hemolysis at 20μM, 0.5% hemolysis at 30μM, 0.5% hemolysis at 200μM against human red blood cells |
|---|
| Cytotoxicity | [Ref.31045339] ①The cell viability of Hela cells induced by CecB Q53 is 102.6%, 104.0%, 99.1% and 95.6% at peptide concentrations of 10, 20, 30 and 200 μM. ②The cell viability of CCD cells induced by CecB Q53 is 108.4%, 111.5%, 108.8% and 88.5% at peptide concentrations of 10, 20, 30 and 200 μM. |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Amidation |
|---|
| Linear/Cyclic/Branched | Linear |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 31045339 |
|---|
